This question was answered on Sun 03, Jan 2010 11:18am by Dr Vinod, MBBS,FcGP

My three middle toes on my right foot have been going numb and it is starting tohappen quite frequently.

    
Asked by dkmv3 (Female; 43; brain tumor removed in 2000; Relevant drugs:Prozac and Acipex ) on Sat 02, Jan 2010 11:09am

My three middle toes on my right foot have been going numb and it is starting to happen quite frequently.

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by Dr Vinod, MBBS,FcGP  on Sun 03, Jan 2010 11:18am:

Hello dkmv3, The most common reason is due to tight footwear and I would suggest you to wear proper footwear. The other reasons are conditions like diabetes, hypertension or anemia. If you do not have any of these conditions it may be due to injury, twist or fall effecting your toes or ankle which is causing this. Exercise your toes and wear proper footwear and if this continues get yourself examined. Take care!
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

Comments:

Comment by on Thu 31, Mar 2011 07:13pm:
Numbness in toes can be due to vitamin deficiency, physical injury (trauma) to a nerve, diabetes, autoimmune responses, alcoholism and several other reasons.Get your Vit B12 checked and if there is deficiency ,your doctor will give you the Vitamin B12 supplement .

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post


 
What users are searching right now on Ask Medical Doctor:
cost     missed pill     can urinary tract infection cause low blood protein levels     Hbocvaccine     blood on food     iam22yearsoldhealthyandfitIcanrun115milesinasinglestretchperdayIwentforpreemploymentmedicalcheckupsfoundthatmyBPwas14595Fastingovernightabout12hrsSotheysaidtheywilltakeanotherreadingfewh     je sens ma tete est lourd et jai mal de tete     likoria79584likoria     where is the free part     spots20on20the20brain20in20a20ct20scan     whichcreamishelptheincreasemyfacebeautyglowingskinwhitenesssjin     PterygiumorPteridium     adima     can i just get a penectomy     Skinisitchypeelingbutskinisnotalldeadandhaver     willsoyproductsadverselyaffectjoints     Gnc mega mens performance and vitality vitapak     RASHONFACE     clean from opiates     itchy bumps on fingers     painful right lower abdomen with white mens 11 years old     hca     bumpsonface     lipcancer     allergic rhinitis     Hboc     sugar     barotrauma     testies pain     bleedingduringintercourse     Ribs     eyetwitchejaculate     eyetearing     eyeproblems     menieres     eyebubbleswhenblowingnose     eyebrowhairloss     legsswelling     image     eye infection     viritgo     extendedstomachpainonrightside     experiencingheartfluttersdizz     exhaustedbloodsugarwontcomedownpainallover     Tinglinginfingersdizzinessblurredvision     when enzimes attack your mussles     exesiveprispiring     dolor y ardor en el seno izquierdo     execiveanalbleedingshouldigetcheckedout     excessvaginallubricationduringsex     excercisetostopPE     examplesofcephalosporins     Hayzine     BellyButtonpa     cheiltis     etgtesting     Headache and shortness of breath     estaradiollevelof43inbloodtest     erectiongirlfriend     epstienbarr     what causes irregular cycles     epithelialcellsinpapsmear     epiditimous     enlargedveinsonthekneecap     Search for hi i m 18 yr old and after mastibution pain start in my legsanswers     enlargedspleenandhighamalyse     enlargedprostrate     enlargedprostate     how do i relieve chest pain     enlarged veins on the knee capA0     enlarged veins on the knee cap     enlarged liver fatty deposits     shortness     enla     energydrinksandalcohol     energydrinkafterctscan     enemaexpulsion     endometrial eblation     endocarditis     restlesslegsyndrome     endocarcinoma     endermetrious     encephaltitis     encelophaty     clogged tear duct     emjSearch     whiteheadremoval     emilym     emergencypill     emergencycontraception     nero dr     electrocardiogram     E     elderly     antibiotics for sinus infection     ejaculating out the anus     ejaculatewithoutanerection     birthcontrols     ejaculate     effectsofherpesvirus     effectoftvonsleep     pain after intercourse     ed     panadolsideeffect     ecosprininpregnency     ecosprin 75     endrometreosis cause cancer     ecaterina     eatinglemonafterdrinkingalcohol     eatinalotofjunkfood     what are sign of sufur allergy     easy     easy six vaccination for baby     earwaxremoval     earstoppedupwhenIgetupforthela     can lekoria effect the periods     earsoundslikewater     earproblem     exercise allergy     earpopping     earlyperiod     earinfection     stinkybutt     testacel pain     ear numb     dysphagia     dysfunctional uterine bleeding     dysarrythmais     infection in penis     mease     dyguesia     dusri bar sex krny sy bleeding hoti hai     duro     can I swallow womens sperm     largepainful     duringtotlartin i see blood drops     duri     duodenalulcer     duodenalpeptic     duodenalpeptic ulcer     large hive on hard palate     dundraf     when does Dr Anant Joshi visits Fortis mohali     dullconstantpaininrightbackunderribcageandintorightside     toradolinliver     dullacheonbothsidesoflowerbacka     Search for answers     dullacheonbothsidesoflowerback     Search for answers     

©2011 - Ask Medical Doctor  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on AskMedicalDoctor is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence AskMedicalDoctor and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats