This question was answered on Sun 21, Feb 2010 07:21pm by Dr.Kokil Mathur

Red, sore patch on my tongue , enterococcus growth, yeast.

Asked by Anonymous123 (Female; 59; UNITED STATES; chronic Bacterial vaginal infections over past 2 months...gardnerella, 1 yeast, & a cultured yest growth, & large amounts of Klebsiella & Enterococcus grown in Vaginal cultures plus enterovcoccus grown in midstream urine sample on gram stain. Interstitial cystitis, fibromyalgia, thyroid nodules & goiter.; Relevant drugs:Elmiron, Trazadone at bedtime, Clonidine at bedtime, Diflucan 2 x a week for 12 weeks, VagiFem inserts & premarin cream for atrophic vaginitis baby aspirin & vitamins. ) on Sun 21, Feb 2010 02:51pm

This question is for Dr. Kokil Mathur if he is available since he has been answering my questions.Otherwise, another DR. who deals with this. For about a month now I have had a red patch on my tongue which looks and feels as if I burned it on something hot, but I didn't. I did some research and came up with photos and descriptions of various things, but none that quite match my symptoms or the placement of what I have. The patch is located on the left front area on my tongue.From the tip it extends back about an inch onto the top of the tongue & goes to the middle, so it's about 1 " x 3/4 " or so. It burns & is sensitive to salt & spices etc. I still do have the papillae or I would think it might be candidias erythmatous. That it says is usually in the middle of the mouth though,& mine isn't. They also say the little red bumps are gone with that,& mine aren't. Geographic tongue has white borders & is smooth with the papillae gone too, but mine has no white borders & I still have the bumps. It isn't smooth. Atrophic doesn't sound much like it either. I am very fearful of course that it could be cancer since I read that sore red patches that don't go away are a symptom of tongue cancer. I pray that it isn't that!It began about the time that I completed a 10 day course of Vancomycin to treat a vaginal enterococcus growth. I later found out that treatment was useless because the oral form of vancomycin doesn't reach the vagina & stays confined to the colon. Anyway, I thought that might cause a yeast infection, or that the enterococcus may cause this somehow. I also had yeast cultured while I was at the Mayo Clinic & the dermatologist recommended that I take 100 mg diflucan every day for a week followed by 2 x a week for 12 weeks. That seems like a very long treatment on a very powerful systemic drug, and I am reluctant to take it for that long. I have already completed the 7 days,& actually I have had a lot of vaginal itching for 6 days while on it, plus some cracks in the skin in the outer vaginal area. I read that a person can get a new yeast inf. even while on the diflucan. I am fearful of the side effects of diflucan & don't want the yeast to build up a resistance to it or mutate & become even more of a problem. Aren't there safer drugs to treat yeast? I only have had a couple of yeast infections this past year, & one wasn't candida albicans, so it seems like overkill to me to be on it for 13 weeks total. I don't know if the diflucan has anything to do with this red, sore patch in my mouth. I also wonder about vitamin deficiencies causing it or anemia or B12? Should I see an ear. nose throat Dr. or an oral surgeon to get a proper diagnosis? I am hoping that you may be able to give me an idea of what it might be, & hopefully reassure me that it isn't cancer. I have never smoked or drank, but I read that about 25% of people who get it don't do that either.So scary! I also had a midstream urine taken that showed a growth of enterococcus. This was after a catherization had been done which showed no infection, but the nurse in training tried 4 times to insert the cath tube & I think introduced some enterococcus into my bladder.I got symptoms of a bladder infection & had did a midstream urine culture with a gram stain. I told you about this in my last email, but it may be significant. A microbiologist looked over all my allergies & history and felt that in my case it would be best not to treat the enterococcus. He said it could be a contamination, & I think that's possible as I feel I may have contaminated that sample. I am wondering since I never really treated the vaginal enterococcus growth or this growth from the midstream, if I have to worry about it getting into my kidneys or bloodstream? Can enterococcus go away w/out treatment or remain there without being harmful? I can't recall for sure what the count was that she told me, but I think she said it was low to moderate. I mainly want to know if the enterococcus is safe to leave untreated since I have so many serious allergies if my symptoms go away? Is the diflucan really safe to take for 13 weeks or is there a safer alternative?And, Do you have a guess what the reddish, sore patch on my tongue can be? Thank you very much!! Dr. Kokil Mathur has been so wonderful in answering my questions.

Actions: | Forward |



Security code
Enter the text as shown above

E-Mail me when someone replies to this post
Answer by Dr.Kokil Mathur  on Sun 21, Feb 2010 07:21pm:

Hi Anonymous123! Welcome back to the forum. I am glad we are able to provide some support within the constraints of net and wish you a speedy recovery and ailment free life! A sore red spot on the tongue can be cancer (naturally the first thing coming to your mind). However before you jump to the conclusion, considering your medical history, there is a much bigger chance that it is canker sore. You have been taking antibiotics which bring about an immune-compromised state in the body resulting in these sores. This type of sores can also be triggered by emotional stress (which naturally you have plenty), deficiencies of iron, folic acid, or vitamin B-12, during menstrual periods, hormonal changes, and food allergies. Hence in my mind this should be the first diagnosis. Avoid spicy and salty meals. Apply a mixture of hydrogen peroxide and water in equal ratio by a cotton swab to the area. Mouth gels for these sores are available OTC and can be tried. Take a multivitamin pill that you are comfortable with. Take this treatment for a week. If this does not help, then yes, you will need to see a specialist (skin or oral diseases). Also you will need to run tests to know if you have deficiency of any of the above mentioned nutrients. Risk for cancer is always there but as a last option. Fungal infections are very notorious and leave human body with a lot of difficulty. Hence the treatment prescribed will have to be taken daily for a week as you have, then twice a week for 12 weeks as you will now be taking. You can eat a healthy diet and take lactobacillus preparations or curd to overcome the side effects of this drug. Taking the drug after a complete meal often helps. All antifungal drugs are strong medicines, so this is good enough. Enterococcus is normally found in human gut. This is the source of infection usually as anus and vagina are close by. Normally it does not cause severe infection. If the growth was mild to moderate, improving the local flora of the vagina will help. Thus taking lactobacillus preparation orally will help too. In all probability this will not spread to kidney. However talk to your doctor form Mayo regarding the possibility as some infection has been introduced into the bladder. Drink plenty of fluids. Another thing which I want to highlight (sorry since I do not remember correctly) is to get the diabetes status checked. At times pre diabetes too leads to persistent infection. Hence glycosylated hemoglobin, fasting and post prandial sugar and blood insulin levels should be done. Please ignore this if already been tested. Hope this answers your query. If you need further clarifications to this please feel free to ask. Take care and get well soon!

If you find the site useful, please consider making a donation.  Click the button to donate.   

Please rate my answer (select the stars, no need to log in.)  


Comment by Dr.Ravindra Rajput on Sun 21, Feb 2010 08:02pm:
Hi, I totally agree with Dr.Kokil Mathur, first thing to be ruled out is squamous cell carcinoma, which can present as ulcerative lesion but we will take it as unlikely cause. The biopsy of the margin of the ulcer will help to rule out the type of tissue. One of the commonest cause suspected can be candida, it can present in many ways (plaque, erythematous and beefy appearance). Nystatin suspension, nystatin troche or clotrimazole troche are the topical preparations which is quite effective and safe than systemic diflucan tablets. An endoscopy can be done to rule out esophageal candidiasis. Viral infections with Varicella-zoster and virus Coxsackie virus can cause but is unlikely. As you said vitamin and mineral (Vitamin B series and iron, Zn etc.) deficiency can also cause such lesions, hemoglobin levels are needed to be evaluated. I suggest you to consult a physician for systematic evaluation and confirmation of the diagnosis. Take care and regards.

This question is open for comments.  Please share your opinion.




Security code
Enter the text as shown above

E-Mail me when someone replies to this post

What users are searching right now on Ask Medical Doctor:
Ihaveadrypatchofskinonmyscalpthat     gastrosolrus lengthening surgery     cost     missed pill     can urinary tract infection cause low blood protein levels     Hbocvaccine     blood on food     iam22yearsoldhealthyandfitIcanrun115milesinasinglestretchperdayIwentforpreemploymentmedicalcheckupsfoundthatmyBPwas14595Fastingovernightabout12hrsSotheysaidtheywilltakeanotherreadingfewh     je sens ma tete est lourd et jai mal de tete     likoria79584likoria     where is the free part     spots20on20the20brain20in20a20ct20scan     whichcreamishelptheincreasemyfacebeautyglowingskinwhitenesssjin     PterygiumorPteridium     adima     can i just get a penectomy     Skinisitchypeelingbutskinisnotalldeadandhaver     willsoyproductsadverselyaffectjoints     Gnc mega mens performance and vitality vitapak     RASHONFACE     clean from opiates     itchy bumps on fingers     painful right lower abdomen with white mens 11 years old     hca     bumpsonface     lipcancer     allergic rhinitis     Hboc     sugar     barotrauma     testies pain     bleedingduringintercourse     Ribs     eyetwitchejaculate     eyetearing     eyeproblems     menieres     eyebubbleswhenblowingnose     eyebrowhairloss     legsswelling     image     eye infection     viritgo     extendedstomachpainonrightside     experiencingheartfluttersdizz     exhaustedbloodsugarwontcomedownpainallover     Tinglinginfingersdizzinessblurredvision     when enzimes attack your mussles     exesiveprispiring     dolor y ardor en el seno izquierdo     execiveanalbleedingshouldigetcheckedout     excessvaginallubricationduringsex     excercisetostopPE     examplesofcephalosporins     Hayzine     BellyButtonpa     cheiltis     etgtesting     Headache and shortness of breath     estaradiollevelof43inbloodtest     erectiongirlfriend     epstienbarr     what causes irregular cycles     epithelialcellsinpapsmear     epiditimous     enlargedveinsonthekneecap     Search for hi i m 18 yr old and after mastibution pain start in my legsanswers     enlargedspleenandhighamalyse     enlargedprostrate     enlargedprostate     how do i relieve chest pain     enlarged veins on the knee capA0     enlarged veins on the knee cap     enlarged liver fatty deposits     shortness     enla     energydrinksandalcohol     energydrinkafterctscan     enemaexpulsion     endometrial eblation     endocarditis     restlesslegsyndrome     endocarcinoma     endermetrious     encephaltitis     encelophaty     clogged tear duct     emjSearch     whiteheadremoval     emilym     emergencypill     emergencycontraception     nero dr     electrocardiogram     E     elderly     antibiotics for sinus infection     ejaculating out the anus     ejaculatewithoutanerection     birthcontrols     ejaculate     effectsofherpesvirus     effectoftvonsleep     pain after intercourse     ed     panadolsideeffect     ecosprininpregnency     ecosprin 75     endrometreosis cause cancer     ecaterina     eatinglemonafterdrinkingalcohol     eatinalotofjunkfood     what are sign of sufur allergy     easy     easy six vaccination for baby     earwaxremoval     earstoppedupwhenIgetupforthela     can lekoria effect the periods     earsoundslikewater     earproblem     exercise allergy     earpopping     earlyperiod     earinfection     stinkybutt     testacel pain     ear numb     dysphagia     dysfunctional uterine bleeding     dysarrythmais     infection in penis     mease     dyguesia     dusri bar sex krny sy bleeding hoti hai     duro     can I swallow womens sperm     largepainful     duringtotlartin i see blood drops     duri     duodenalulcer     duodenalpeptic     duodenalpeptic ulcer     large hive on hard palate     dundraf     when does Dr Anant Joshi visits Fortis mohali     dullconstantpaininrightbackunderribcageandintorightside     toradolinliver     dullacheonbothsidesoflowerbacka     Search for answers     

©2011 - Ask Medical Doctor  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on AskMedicalDoctor is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence AskMedicalDoctor and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us